Engineering Manager, Workforce Payments
New Yorkonsitemanager$220K – $242K
via Greenhouse
About this role
Who We Are
At Justworks, you’ll enjoy a welcoming and casual environment, great benefits, wellness program offerings, company retreats, and the ability to interact with and learn from leaders in the startup community. We work hard and care about our most prized asset - our people.
We’re helping businesses get off the ground by enabling them to focus on running their business. We solve HR issues. We’re data-driven and never stop iterating. If you’d like to work in a supportive, entrepreneurial environment, are interested in building something meaningful and having fun while doing it, we’d love to hear from you.
We're united by shared goals and shared motivations at Justworks. These are best summed up in our company values, which are reflected in our product and in our team.
Our Values…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, ruby, r, rails, mysql…
2
Level fit
This role is manager-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in New York. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptrubyrrailsmysqlrediselasticsearchawskubernetesdockerterraformcirclecidatadogkafkagitteams
More at Justworks
- View →GTM EngineerNew York, New York
- View →Software EngineerNew York, New York
- View →Senior Developer Experience EngineerMexico City, Mexico; New York, New York; Toronto, Canada
- View →Senior Product Manager, BenefitsNew York, New York
- View →Manager, Engineering EnablementNew York, New York
- View →Manager, Sales DevelopmentPhoenix, Arizona
