Software Engineer II, Reliability
Dublinonsitemid
via Greenhouse
About this role
At Klaviyo, we value the unique backgrounds, experiences and perspectives each Klaviyo (we call ourselves Klaviyos) brings to our workplace each and every day. We believe everyone deserves a fair shot at success and appreciate the experiences each person brings beyond the traditional job requirements. If you’re a close but not exact match with the description, we hope you’ll still consider applying. Want to learn more about life at Klaviyo? Visit klaviyo.com/careers to see how we empower creators to own their own destiny.
Software Engineer II, Reliability (Dublin)
Team Overview:
As a Software Engineer II, Reliability, you will help ensure Klaviyo’s critical platforms are reliable, scalable, and sustainable while enabling rapid product development.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, go, react, django, fastapi…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Dublin. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythongoreactdjangofastapimysqlredismemcachedawskubernetesterraformkafkapulsarrabbitmqteamsklaviyo
More at Klaviyo
- View →Commercial ManagerSydney, AU
- View →Engineering Manager, Profile TraitsBoston, MA
- View →Lead AI Software EngineerBoston, MA
- View →Lead Data Science Analyst, GTM Strategic Analytics and InsightsBoston, MA
- View →Lead Product Marketing Manager - EnterpriseSan Francisco, CA
- View →Account Executive - Mid EnterpriseParis, FR
