K
KnowbeSoftware Development

Staff Software Engineer (Hybrid)

Clearwateronsitestaff

via Greenhouse

About this role

KnowBe4 empowers the modern workforce to make smarter security decisions every day. Trusted by more than 70,000 organizations worldwide, KnowBe4 is the pioneer of digital workforce security, securing both AI agents and humans. The KnowBe4 Platform provides attack simulation and training, collaboration security, and agent security powered by AIDA (Artificial Intelligence Defense Agents) and a proprietary Risk Score. The platform leverages 15-years of behavioral data to combat advanced threats including social engineering, prompt injection, and shadow AI. By securing humans and agents, KnowBe4 leads the industry in workforce trust and defense. We are seeking a Staff Software Engineer to join the KSAT Architecture Team — the engineering powerhouse behind our core product.…

Read the full description on Knowbe's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, ruby, react, vue, svelte…

2

Level fit

This role is staff-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Clearwater. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptrubyreactvuesveltesveltekittailwindviterailsgraphqlpostgrespostgresqlmysqldynamodbredisawss3lambdafargatesqsterraformserverlessgitlabsoc 2

More at Knowbe

See all open jobs at Knowbe