Frontend Developer (React / Shopify Hydrogen)

Mexico Cityremotemid

Posted 1mo ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

Remote: Latin America , Philippines and Eastern Europe. Schedule: 09:00 AM- 5:00 PM Central Time Salary: Up to $20 per hour ( USD monthly up to $3,200) We are seeking an experienced Frontend Developer with strong React, React Router, and Shopify Hydrogen experience to maintain and continuously improve an existing headless ecommerce storefront. This is primarily a frontend-focused position. The developer will work within an established custom codebase and collaborate with technical and nontechnical stakeholders to build polished ecommerce experiences, troubleshoot technical issues, evaluate feature feasibility, and recommend practical solutions. The ideal candidate is more than a React developer who has worked with Shopify.…

Read the full description on Lago's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, html, css, react, graphql…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is remote-eligible. We factor in your stated location and time-zone overlap.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssreactgraphqlgitklaviyo

More at Lago

See all open jobs at Lago →