Frontend Developer (React/Shopify Hydrogen)

Bosnia and Herzegovinaremotemid

Posted 1mo ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

Job Title: Frontend Developer (React / Shopify Hydrogen) Location: Eastern Europe - Remote Schedule: Full-Time (40 hours/week), 9am - 5pm Eastern Standard Time Salary Range: Up to $3200 Our Partner is a US-based e-commerce retailer running a custom headless storefront. They are looking for an experienced Frontend Developer with strong React, React Router, and Shopify Hydrogen experience to help maintain and improve their existing headless storefront, and potentially support future migrations of additional e-commerce sites to Shopify/Hydrogen. This is primarily a frontend role.…

Read the full description on Lago's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, html, css, react, graphql…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is remote-eligible. We factor in your stated location and time-zone overlap.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssreactgraphqlgitklaviyo

More at Lago

See all open jobs at Lago →