LagoE-commerce

Frontend Software Engineer (Mid-Senior)

Philippinesremotesenior

Posted 9mo ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

Role: Frontend Software Engineer (Mid–Senior) Hours: Pacific Timezone USD Monthly Rate: Competitive salary based on experience The Frontend Software Engineer is responsible for building high-quality, intuitive, and responsive user interfaces within our modern React applications. This role focuses heavily on front-end engineering best practices, advanced component architecture, and the ability to translate Figma/design system specifications into polished, production-ready features. The ideal candidate is an expert in React and React Router, with a strong foundation in TypeScript, reusable component development, and interactive visualization tools such as Recharts.…

Read the full description on Lago's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: typescript, css, react, tailwind, figma…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is remote-eligible. We factor in your stated location and time-zone overlap.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptcssreacttailwindfigmasketchadobe xd

More at Lago

See all open jobs at Lago →