CRM Application Engineer
Chiassohybridmid
Posted today · via Smartrecruiters
About this role
About At lastminute.com, we live for the holidays. We are the European Travel-Tech leader in Dynamic Holiday Packages. With technology, we turn spontaneous thoughts into meaningful experiences, helping people travel the world. We are looking for a CRM Application Engineer to join our team of around 1,700 people worldwide to help us power up the traveller's journey for millions of holidaymakers.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, sql, html, css…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Chiasso. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphpsqlhtmlcssmysqlawsgitlabteamssalesforce
More at lastminute.com
- View →Administrative B2B SpecialistChiasso, TI, Switzerland
- View →Agent Customer Support (English Speaking agents)Bengaluru, KA, India
- View →Software Engineering - Finance Core PlatformChiasso, TI, Switzerland
- View →Junior AccountantChiasso, TI, Switzerland
- View →Data EngineerChiasso, TI, Switzerland
- View →Agent - TelesalesBengaluru, KA, India