Frontend Engineer
Vancouveronsitemid
via Greenhouse
About this role
LayerZero
The Future is Omnichain.
Founded in 2021, LayerZero’s vision is to create a community of cross-chain developers, building dApps that are no longer constrained by individual blockchain capabilities. With LayerZero's simple, generic messaging protocol, builders will develop cross-chain dApps designed to unify the power of individual blockchains.
We are funded by the best investors in the world including:
a16z, Sequoia, PayPal, Binance Ventures, Coinbase Ventures, Uniswap Labs, Circle Ventures, Delphi Digital, and many more.
ABOUT THE ROLE
We are hiring a Frontend Engineer to be at the forefront of driving our mission to enhance blockchain interoperability and unlock the full potential of cross-chain decentralized applications.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, elasticsearch, aws, slack…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Vancouver. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreactelasticsearchawsslacksequoia
