L
LayerzerolabsEngineering

Frontend Engineer

Vancouveronsitemid

via Greenhouse

About this role

LayerZero The Future is Omnichain. Founded in 2021, LayerZero’s vision is to create a community of cross-chain developers, building dApps that are no longer constrained by individual blockchain capabilities. With LayerZero's simple, generic messaging protocol, builders will develop cross-chain dApps designed to unify the power of individual blockchains. We are funded by the best investors in the world including: a16z, Sequoia, PayPal, Binance Ventures, Coinbase Ventures, Uniswap Labs, Circle Ventures, Delphi Digital, and many more. ABOUT THE ROLE We are hiring a Frontend Engineer to be at the forefront of driving our mission to enhance blockchain interoperability and unlock the full potential of cross-chain decentralized applications.…

Read the full description on Layerzerolabs's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, react, elasticsearch, aws, slack…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Vancouver. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptreactelasticsearchawsslacksequoia

More at Layerzerolabs

See all open jobs at Layerzerolabs