Senior Data Engineer (Databricks)
Remote (USA)Remote (US)senior$150K – $180K
via Greenhouse
About this role
At Livefront, we help companies design and build world-class digital products that command attention and inspire joy. We’ve helped household names like CVS, Samsung, General Mills, and Optum create experiences that have reached millions of people, and startups like HomeSpotter and Credly build entirely new businesses that challenge their industries’ status quo. We're looking for an outstanding Senior Databricks Data Engineer to join our growing data practice — someone who builds the data and AI foundations that digital products and intelligent experiences run on. Who you are You are a Databricks-focused Data Engineer who understands that great data platforms are only as valuable as the products, AI workflows, and experiences they enable.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, go, sql, databricks…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavagosqldatabricksawsazuregcpkinesisiamsparkpysparkkafkadbtmlflowgitgithubteams