Engineer III, Software/Web Development

Curitibaremotemid

Posted 1mo ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About A Loram South América é uma empresa líder no fornecimento de equipamentos e serviços de manutenção de via permanente para ferrovias. Com um forte compromisso com a qualidade e a inovação, estamos em constante crescimento na América do Sul, expandindo nossas operações e fortalecendo nossa presença no mercado. Estamos em busca de pessoas engajadas, que desejam crescer e se desenvolver junto conosco. Valorizamos profissionais que compartilham nossa paixão por excelência e que estão dispostos a contribuir para o sucesso da empresa. Se você é uma pessoa proativa, com vontade de aprender e se aprimorar, a Loram é o lugar ideal para você.…

Read the full description on Loram's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: c#, sql, react, tanstack, tailwindcss…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is remote-eligible. We factor in your stated location and time-zone overlap.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

c#sqlreacttanstacktailwindcssasp.net.netdynamodbawss3ec2lambdasqsclaudeteams

More at Loram

See all open jobs at Loram →