Software Engineer
remotemid
via Ashby
About this role
Software Engineer
The Role
We're looking for a Software Engineer to help us build the systems that power Lyrebird for tens of thousands of clinicians. You'll work closely with engineering and product to ship features, scale our systems, and take ownership of problems end to end - from the first line of code through to the impact it has on real users.
This role suits someone with a pioneering, curious mindset - someone who's motivated by ambiguity rather than slowed down by it, who communicates clearly, and who wants their work to matter well beyond the codebase. You'll enjoy the pace and autonomy of a fast-moving team, and the satisfaction of watching your work reach clinicians who rely on it every day.
About Us…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, svelte, sveltekit, aws, gcp…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptsveltesveltekitawsgcpclaudeteams