Agentic AI Software Engineer

Munichhybridmid

Posted 1w ago · via Recruitee

See if I'm a fit →Tailor my resume for this role →Apply on Recruitee ↗

About this role

We are looking for a skilled and motivated Consultant to join our team. The ideal candidate combines strong software engineering expertise with hands-on experience in modern AI systems, including agentic AI and generative AI applications. You will support our clients in designing and building intelligent, production-ready systems that leverage LLMs, autonomous agents, and scalable cloud architectures. Responsibilities: · Design, build, and deploy scalable, production-grade systems on cloud platforms such as AWS, GCP, or Azure. · Develop and operate agentic AI systems, including multi-step workflows, tool integration, and autonomous decision-making components. · Lead end-to-end implementation of AI-driven features, from prototyping (PoC) to production deployment.…

Read the full description on Machine Learning Reply's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, java, rust, sql, flask…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Munich. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavarustsqlflaskfastapispringawsgcpkubernetesdockerpytorchtensorflowlangchainopenaiteams

More at Machine Learning Reply

See all open jobs at Machine Learning Reply →