Agentic AI Software Engineer
Munichhybridmid
Posted 3 days ago · via Recruitee
About this role
We are looking for a skilled and motivated Consultant to join our team. The ideal candidate combines strong software engineering expertise with hands-on experience in modern AI systems, including agentic AI and generative AI applications. You will support our clients in designing and building intelligent, production-ready systems that leverage LLMs, autonomous agents, and scalable cloud architectures. Responsibilities: · Design, build, and deploy scalable, production-grade systems on cloud platforms such as AWS, GCP, or Azure. · Develop and operate agentic AI systems, including multi-step workflows, tool integration, and autonomous decision-making components. · Lead end-to-end implementation of AI-driven features, from prototyping (PoC) to production deployment.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, rust, sql, flask…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Munich. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavarustsqlflaskfastapispringawsgcpkubernetesdockerpytorchtensorflowlangchainopenaiteams
More at Machinelearningreply
- View →Machine Learning Consultant (m/w/d)Munich, Germany
- View →Quantum Application Developer (m/w/d)Munich, Germany
- View →Data & AI Strategy Consultant (m/f/d)Vienna, Austria
- View →(Senior) Data Scientist (m/f/d)Vienna, Austria
- View →(Senior) Cloud Engineer (m/f/d)Vienna, Austria
- View →(Senior) GenAI Engineer (m/f/d)Vienna, Austria
