M
MachinelearningreplyData Frameworks

Agentic AI Software Engineer

Munichhybridmid

Posted 3 days ago · via Recruitee

About this role

We are looking for a skilled and motivated Consultant to join our team. The ideal candidate combines strong software engineering expertise with hands-on experience in modern AI systems, including agentic AI and generative AI applications. You will support our clients in designing and building intelligent, production-ready systems that leverage LLMs, autonomous agents, and scalable cloud architectures. Responsibilities: · Design, build, and deploy scalable, production-grade systems on cloud platforms such as AWS, GCP, or Azure. · Develop and operate agentic AI systems, including multi-step workflows, tool integration, and autonomous decision-making components. · Lead end-to-end implementation of AI-driven features, from prototyping (PoC) to production deployment.…

Read the full description on Machinelearningreply's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, java, rust, sql, flask…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Munich. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavarustsqlflaskfastapispringawsgcpkubernetesdockerpytorchtensorflowlangchainopenaiteams

More at Machinelearningreply

See all open jobs at Machinelearningreply