Design Engineer

mid$120K$250K

via Ashby

About this role

HI 👋 I’M AIDAN, FOUNDER OF MAPLE. At Maple https://maple.inc, we’re building AI agents that work for restaurants. These agents answer calls, take orders, book appointments, and handle real customer interactions over natural voice. But our bigger mission goes deeper: we’re building automated ontologies that model how businesses actually operate — their services, workflows, constraints, and language — so our agents can adapt to them instantly. We meet businesses where they are, not where software wants them to be. We have many customers, strong revenue growth, years of runway, and backing from world-class investors. I’ll share more once we meet. ABOUT THE ROLE As a Design Engineer, you’ll be at the center of how we build products.…

Read the full description on Maple's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, css, react, tailwind, figma

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptcssreacttailwindfigma

More at Maple

See all open jobs at Maple