M
Mc Fadyen DigitalInformation Technology

Senior Full Stack Developer

Bengalururemotesenior

Posted 7mo ago · via Smartrecruiters

About this role

About McFadyen Digital is the leading advisor and implementer of eCommerce Marketplace solutions. During 15 years of implementing marketplaces, we’ve built dozens of platforms that cumulatively generate billions of dollars of gross merchandise value (GMV). We’re honored to have supported 10% of the Fortune 500 with their digital marketplace initiatives. Over 250 global brands like ABB, AB InBev, ACCO, Albertsons, American Red Cross, American Eagle Outfitters, US Army, US Agriculture Dept, (and many more) have entrusted their digital transformations to McFadyen. We operate global offices across the US, Brazil, and India. McFadyen Digital has been a trusted employer for over 37 years and believes that people are the most important part of our company.…

Read the full description on Mc Fadyen Digital's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, python, java, php, sql…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptpythonjavaphpsqlhtmlcsssassreactvueangularjquerynode.jsnodejsgraphqlrestfulpostgresqlmysqlelasticsearchawskubernetesdockergitjira

More at Mc Fadyen Digital

See all open jobs at Mc Fadyen Digital