reqspace
Start free trial →
M
Mdtkangaroo

Senior Clinical Data Engineer

Virtualonsitesenior

Posted yesterday · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

At MiniMed, you can begin a lifelong career of exploration and innovation, while helping make a difference in the lives of people living with diabetes around the globe. You'll lead with purpose, breaking down barriers to innovation for a more connected, compassionate world. About the Role MiniMed is seeking a Senior Clinical Data Engineer to join our Bioinformatics team and play a key role in developing scalable data solutions that support clinical research, medical device studies, and real-world data initiatives. This role is responsible for building and optimizing data pipelines, integrating complex data from multiple sources, and transforming raw data into high-quality datasets that enable analytics, evidence generation, and informed decision-making.…

Read the full description on Mdtkangaroo's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: r, sql, databricks, redshift, aws…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Virtual. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

rsqldatabricksredshiftawspysparkgitteamsjson

More at Mdtkangaroo

See all open jobs at Mdtkangaroo →