M
MedsienEngineering

UI/UX Designer

Istanbulonsitemid

via Greenhouse

About this role

Medsien is the leading provider of scalable remote care management for a quality patient experience. Hundreds of organizations trust Medsien's unparalleled technology solutions to implement exceptional remote care management programs, personalize every interaction, and improve the lives of the people who need it most. Based in San Francisco and venture-backed by top-tier investors, Medsien was founded to reimagine remote care management. More than 60% of all U.S. adults—over 150 million people—live with at least one chronic condition, which requires dedicated, ongoing medical support outside the four walls of their doctor's office. And yet, only 20% of these patients have access to remote care from the comfort of their homes, putting their health at significant risk.…

Read the full description on Medsien's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, less, figma, sketch, teams…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Istanbul. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptlessfigmasketchteamsgdpr

More at Medsien

See all open jobs at Medsien