Senior Vice President, Data Operations
New Yorkonsitevp$315K – $375K
Posted 1w ago · via Workday
About this role
Job Title Senior Vice President, Data Operations Job Description About The Position | Major goals and objectives and location requirements We are seeking a Senior Vice President of Data Operations to lead the strategy, architecture, and execution of our enterprise-wide data infrastructure. As a data-first media company operating at petabyte scale, data is the connective tissue across our editorial, product, advertising, and audience development functions. This is a defining leadership role for someone who can operate at the intersection of deep technical excellence and enterprise strategy — architecting the systems that power how we understand our content, our audiences, and our business.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: snowflake, bigquery, redshift, aws, gcp…
2
Level fit
This role is vp-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in New York. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
snowflakebigqueryredshiftawsgcpkafkaflinkairflowdagsterdbtteamsgdpr
More at Meredith
- View →Paid Search Manager, InvestopediaNew York, NY - 225 Liberty Street
- View →Director, Financial ReportingDes Moines, IA - 1716 Locust Street
- View →Food/Prop StylistNew York, NY - 225 Liberty Street
- View →Studio TechNew York, NY - 225 Liberty Street
- View →Social Media Editor, EWLos Angeles, CA - 1041 N. Formosa Ave
- View →Building Services LeadNew York, NY - 225 Liberty Street