Senior Salesforce Developer
Puneonsitesenior
via Greenhouse
About this role
Are you curious, excited by experimentation and always looking for a better way of doing things?
Do you want to keep learning and developing whilst getting hands-on experience working in the embedded payments space?
Do you want to have the opportunity to be a key member of our automation team?
If so, we would love to connect and collaborate!
We want to hire ambitious, and value-adding talent into Modulr, one of the fastest growing payments businesses in the UK and Europe. Modulr is experiencing significant growth, and in this role you will work in a cross-functional team who are asked to solve a problem, rather than be handed a task to do.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, swift, html, css, teams…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Pune. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptswifthtmlcssteamssalesforce
