M
ModulrfinanceTechnology - Engineering & QA

Senior Salesforce Developer

Puneonsitesenior

via Greenhouse

About this role

Are you curious, excited by experimentation and always looking for a better way of doing things? Do you want to keep learning and developing whilst getting hands-on experience working in the embedded payments space? Do you want to have the opportunity to be a key member of our automation team? If so, we would love to connect and collaborate! We want to hire ambitious, and value-adding talent into Modulr, one of the fastest growing payments businesses in the UK and Europe. Modulr is experiencing significant growth, and in this role you will work in a cross-functional team who are asked to solve a problem, rather than be handed a task to do.…

Read the full description on Modulrfinance's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, swift, html, css, teams…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Pune. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptswifthtmlcssteamssalesforce

More at Modulrfinance

See all open jobs at Modulrfinance