Head of UI/UX
New Cairo Cityonsitedirector
Posted 1mo ago · via Workable
About this role
Mondia Group is a global digital technology company operating across the internet and digital commerce space. We help brands, content providers, merchants, and mobile operators reach consumers through technology, partnerships, and digital commerce solutions across multiple international markets. As Head of UI/UX, you will shape the user experience vision across the product range and help ensure that design decisions are grounded in user needs, strong collaboration, and a high standard of digital experience. This role plays a central part in guiding design leadership and strengthening how user-centred thinking is embedded across the organisation. Responsibilities Serve as the champion for user experience, making sure that user insights drive design decisions.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, figma, sketch…
2
Level fit
This role is director-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in New Cairo City. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssfigmasketchteams
More at Mondia Group
- View →Scrum MasterCairo, Cairo Governorate, Egypt
- View →Senior Backend Engineer IICairo, Cairo Governorate, Egypt
- View →Senior FullStack EngineerCairo, Cairo Governorate, Egypt
- View →Senior QA EngineerNew Cairo City, Cairo Governorate, Egypt
- View →Senior Frontend DeveloperNew Cairo City, Cairo Governorate, Egypt
- View →Digital Campaign ManagerJohannesburg, Gauteng, South Africa
