Head of UI/UX

New Cairo Cityonsitedirector

Posted 1mo ago · via Workable

About this role

Mondia Group is a global digital technology company operating across the internet and digital commerce space. We help brands, content providers, merchants, and mobile operators reach consumers through technology, partnerships, and digital commerce solutions across multiple international markets. As Head of UI/UX, you will shape the user experience vision across the product range and help ensure that design decisions are grounded in user needs, strong collaboration, and a high standard of digital experience. This role plays a central part in guiding design leadership and strengthening how user-centred thinking is embedded across the organisation. Responsibilities Serve as the champion for user experience, making sure that user insights drive design decisions.…

Read the full description on Mondia Group's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, html, css, figma, sketch…

2

Level fit

This role is director-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in New Cairo City. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssfigmasketchteams

More at Mondia Group

See all open jobs at Mondia Group