M
MossApplied AI Engineer
remotemid
via Ashby
About this role
At Moss, we give finance professionals the power to automate their day-to-day and make forward-thinking decisions.
Our culture is what makes that possible: we play to win, we obsess over quality, and we win as One Moss, and it works. Moss closed a €35 million Series C in August 2026, crossing a €1 billion valuation, and became one of Europe's fintech unicorns. Join us for what's next.
We are hiring an Applied AI Engineer to build AI agents and intelligent product capabilities that transform how finance teams work.
This is a product engineering role - not an isolated prototyping or research role. You will own agent-based features end to end: from architecture and evaluation through backend integration, deployment, and operation in production.
YOUR RESPONSIBILITIES…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, sql, rest, postgresql…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible. We factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavasqlrestpostgresqlbigquerygcpkafkaflinklangchainllamaindexopenaianthropicmistralgeminillamavertex aiteams