UI/UX Designer
Calgaryonsitemid
Posted 1w ago · via Workable
About this role
As one of Canada’s largest and fastest growing cryptocurrency trading platforms, Ndax has set the bar high for the country’s fintech industry and is constantly leading the way in terms of security and innovation. We are on a mission to empower more Canadians to unlock the full potential of digital finance. To address the various needs in the Canadian cryptocurrency space, Ndax has assembled a multidisciplinary team with diverse backgrounds, including finance, technology, engineering, compliance, marketing, and more. We are proud to have been recognized as one of Canada’s Best Workplaces by Great Place to Work® Position Overview We are seeking a creative and user-focused UI/UX Designer to craft intuitive and visually compelling digital experiences.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, figma, sketch…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Calgary. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssfigmasketchteams
More at Ndax Canada
- View →Bilingual Customer Support Representative (French and English) - Part-timeCalgary, Alberta, Canada
- View →Product ManagerCalgary, Alberta, Canada
- View →Corporate Legal CounselCalgary, Alberta, Canada
- View →Quality Assurance EngineerCalgary, Alberta, Canada
- View →Head of Product ManagementCalgary, Alberta, Canada
- View →Trader - Market Making SpecialistCalgary, Alberta, Canada
