Lead Data Engineer

Beavertonremotesenior

Posted today · via Workday

About this role

LEAD, DATA ENGINEER - NIKE [Beaverton, OR - USA] WHO YOU'LL WORK WITH Consumer Product and Innovation (CP&I) Data and Analytics Engineering sits at the intersection of product innovation and enterprise data strategy at Nike. Reporting to the Engineering Director, this team partners with data scientists, engineers, analysts, and product managers to build a cross-capability data foundation and a semantic layer that powers Advanced Analytics, Business Intelligence, and AI solutions driving business growth. WHO WE ARE LOOKING FOR We're looking for a Lead Data Engineer to design, build, and maintain scalable data pipelines and analytics solutions within Nike's CP&I organization.…

Read the full description on Nike's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: sql, databricks, rds, aws, s3…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

sqldatabricksrdsawss3kinesissparkpysparkkafkagitteams

More at Nike

See all open jobs at Nike