Agentic Product Engineer | Mid - Senior | Full-stack | Saily

senior$324K$450K

via Ashby

About this role

At Saily, we’re removing the hassle of staying connected while traveling — no roaming fees, no plastic SIM cards, just lightning-fast, secure mobile data in 200+ destinations. Saily has millions of paying customers and hundreds of thousands travelers browsing through Saily at any given moment. To build the best product for our customers we foster AI-native Product Engineering culture, where: - The Engineer is the builder, who is responsible for solving customer problems end-to-end (idea to production) - AI Agents are the enablers who write most of the code and solve repeatable  tasks to  help the Engineers  maximize their impact - Everyone contributes to making Saily effective by suggesting new areas for improvement to delegate to agents and then implementing the changes…

Read the full description on Nord-security's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, go, kotlin, css, next.js…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptgokotlincssnext.jstailwindgraphqlmysqlredisawscloudflarekubernetesdockerkafkaopenaiclaudeteamsxcodeandroid studio

More at Nord-security

See all open jobs at Nord-security