Cassandra DBA
Dallasremote$10K – $15K
Posted 40mo ago · via Smartrecruiters
About this role
About Now100 is committed to understanding our clients’ needs and providing solutions that not only meet but exceed their expectations. We match thoroughly vetted resources to contract, contract-to-hire, and permanent positions in all industries. We are looking for a Cassandra DBA for one of our clients here in Atlanta, GA or Dallas, TX. Please find the position details below and let me know your interest in this.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: sql, postgresql, mysql, cassandra, spanner…
2
Level fit
We check your title trajectory against the seniority signal of the role.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
sqlpostgresqlmysqlcassandraspannerawsazuregcpgoogle cloudterraformansiblechef
More at Now
- View →Account Executive/Client Partner _ Buckhead, GA & Dallas, TXBuckhead, GA, United States
- View →SAP JVA (Joint Venture Accounting) S/4 Hana consultantHouston, TX, United States
- View →Site Reliability Engineer - SREAtlanta, GA, United States
- View →IT Recruiter - Talent Acquisition executiveAtlanta, GA, United States
- View →Sr. IT Project ManagerHuntingdon Valley, PA, United States
- View →Full Stack Developer (React & Java) - FTE & RemoteHuntingdon Valley, PA, United States