O
OnestudyteamApplied Machine Learning & Analytics

Senior Data Scientist

United States-RemoteRemote (US)senior$140K$190K

via Greenhouse

About this role

At OneStudyTeam (a Reify Health company), we specialize in speeding up clinical trials and increasing the chance of new therapies being approved with the ultimate goal of improving patient outcomes. Our cloud-based platform, StudyTeam, brings research site workflows online and enables sites, sponsors, and other key stakeholders to work together more effectively. StudyTeam is trusted by the largest global biopharmaceutical companies, used in over 6,000 research sites, and is available in over 100 countries. Join us in our mission to advance clinical research and improve patient care. One mission. One team. That’s OneStudyTeam. As a Senior Data Scientist, you will play a pivotal role in advancing Reify Health’s data-driven solutions for clinical trials.…

Read the full description on Onestudyteam's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, sql, redshift, aws, athena…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsqlredshiftawsathenasagemakerdbtscikit-learnteamsgdprhipaa

More at Onestudyteam

See all open jobs at Onestudyteam