Senior UI/UX Designer (Shopify Theme Development)

remotesenior$12K$15K

via Ashby

About this role

SENIOR UI/UX DESIGNER (SHOPIFY THEME DEVELOPMENT) Remote (US) | Full-time DESIGN FOR MILLIONS OF FANS. BUILD FOR GLOBAL ARTISTS. Join a team building high-traffic Shopify storefronts for one of the world’s top 3 music labels - powering merch and digital experiences for globally recognized artists. This is not a typical eCommerce role. You’ll be designing and building experiences used by millions of fans worldwide, shaping how they discover, engage with, and purchase from artist brands. ABOUT THE PRODUCT You’ll work on a Shopify-first eCommerce stack focused on merchandise and digital products, built for scale, performance, and global reach.…

Read the full description on Onhires's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, html, css, tailwind, figma…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcsstailwindfigmateams

More at Onhires

See all open jobs at Onhires