Member of Technical Staff, Front-end
$150K – $300K
via Ashby
About this role
ABOUT US
Parallel is a web infrastructure company. Our products are used by leading businesses in sales, marketing, insurance, and coding to build best-in-class AI agents with flexible and powerful programmatic access to the web.
We've raised $230 million from Kleiner Perkins, Sequoia, Index Ventures, Spark Capital, Khosla Ventures, First Round, and Terrain to build the web for AIs. We're currently valued at $2 billion and we're forming a world-class team of engineers, designers, marketers, sellers, researchers, and operational experts to achieve our mission.
ABOUT YOU
You're an expert at modern front-end frameworks, maintainable UI architecture, and building UIs that feel intuitive, fast, and beautiful.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, css, vercel, spark, teams…
2
Level fit
We check your title trajectory against the seniority signal of the role.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in a specific location. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptcssvercelsparkteamssequoia
