Member of Technical Staff, Front-end

$150K$300K

via Ashby

About this role

ABOUT US Parallel is a web infrastructure company. Our products are used by leading businesses in sales, marketing, insurance, and coding to build best-in-class AI agents with flexible and powerful programmatic access to the web. We've raised $230 million from Kleiner Perkins, Sequoia, Index Ventures, Spark Capital, Khosla Ventures, First Round, and Terrain to build the web for AIs. We're currently valued at $2 billion and we're forming a world-class team of engineers, designers, marketers, sellers, researchers, and operational experts to achieve our mission. ABOUT YOU You're an expert at modern front-end frameworks, maintainable UI architecture, and building UIs that feel intuitive, fast, and beautiful.…

Read the full description on Parallel's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, css, vercel, spark, teams…

2

Level fit

We check your title trajectory against the seniority signal of the role.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptcssvercelsparkteamssequoia

More at Parallel

See all open jobs at Parallel