Product Designer, Industrial Solutions
US RemoteRemote (US)mid$130K – $170K
via Greenhouse
About this role
Product Designer, Industrial Solutions Location: US Remote Job Term: Full-Time The Opportunity Picarro is looking for a Product Designer to own the design portfolio across our Industrial Solutions products. This is a hands-on role for someone who thinks in systems, sweats the details, and can move fluidly between design and code. Shaping how our products look, feel, and behave from prototype through production. Good design at Picarro means something specific: our users are compliance managers, EHS leads, and field operators making high-stakes decisions under real-world constraints. We care about clarity, trust, and workflow efficiency — not engagement or delight for its own sake.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, css, react, tailwind, figma…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptcssreacttailwindfigmagreenhouse
More at Picarro
- View →Senior Technical Program ManagerSanta Clara, CA
- View →Senior Staff Software EngineerSanta Clara, CA
- View →Sales Manager – U.S. Refining (Fenceline Solutions)Houston, TX
- View →Systems Engineer - Firmware & Instrument ControlSanta Clara, CA
- View →Senior Electrical EngineerSanta Clara, CA
- View →Optical EngineerSanta Clara, CA
