reqspace
Start free trial →
P
Picarroinc4400 - Industrial Systems - Environmental

Design Engineer, Industrial Solutions

Santa Claraonsitemid$130K – $170K

via Greenhouse

See if I'm a fit →Tailor my resume for this role →Apply on Greenhouse ↗

About this role

Design Engineer, Industrial Solutions Location: Santa Clara (Picarro HQ) / Remote Job Term: Full-Time The Opportunity Picarro is looking for a Design Engineer to own the design portfolio across our Industrial Solutions products. This is a hands-on role for someone who thinks in systems, sweats the details, and can move fluidly between design and code. Shaping how our products look, feel, and behave from prototype through production. Good design at Picarro means something specific: our users are compliance managers, EHS leads, and field operators making high-stakes decisions under real-world constraints. We care about clarity, trust, and workflow efficiency — not engagement or delight for its own sake.…

Read the full description on Picarroinc's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, css, react, tailwind, figma…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Santa Clara. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptcssreacttailwindfigmagreenhouse

More at Picarroinc

See all open jobs at Picarroinc →