Forward Deployed Engineer
remotemid$180K – $250K
via Ashby
About this role
Plain is redefining customer support and customer success for the next generation of B2B companies. We’re building the fastest, most powerful platform to help companies move beyond reactive support and build meaningful customer relationships.
Some of the world’s most forward-thinking companies - like Cursor, Vercel, and Granola - trust Plain to unify all customer interactions, enable faster team collaboration, and supercharge their workflows with AI.
We have offices in SF and London. This role is hybrid with 3 days a week in our SF office. Because we work closely with our teammates in Europe, we start early, but you’ll find quiet afternoons for heads-down work.
WHY THIS ROLE IS SPECIAL
Our most strategic customers do not arrive through self-serve.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, graphql, aws, vercel…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreactgraphqlawsvercelcloudflareterraformgithub actionsdatadoggithub
