Senior Software Engineer, Storage Infrastructure
United StatesRemote (US)senior$46K – $183K
via Greenhouse
About this role
Welcome to Planet. We believe in using space to help life on Earth.
Planet designs, builds, and operates the largest constellation of imaging satellites in history. This constellation delivers an unprecedented dataset of empirical information via a revolutionary cloud-based platform to authoritative figures in commercial, environmental, and humanitarian sectors. We are both a space company and data company all rolled into one.
Customers and users across the globe use Planet's data to develop new technologies, drive revenue, power research, and solve our world’s toughest obstacles.
As we control every component of hardware design, manufacturing, data processing, and software engineering, our office is a truly inspiring mix of experts from a variety of domains.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, go, less, postgresql, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythongolesspostgresqlmysqlelasticsearchawsgcpkubernetesterraformclaudeteamsgdpr
More at Planetlabs
- View →Senior Satellite Constellation ManagerBerlin, Germany
- View →Talent Acquisition Partner, Space SystemsSan Francisco, CA
- View →Product Manager, TanagerUnited States, Remote
- View →Quality Engineer LeadBerlin, Germany
- View →Technical Support Engineer IIIBerlin, Germany
- View →Engineering Program ManagerSan Francisco, CA
