reqspace
Start free trial →
Q
QadincTransformation

Principal AI Engineer - Enterprise Transformation

Puneonsiteprincipal

Posted 2w ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About QAD | Redzone is building an enterprise AI platform to support AI-enabled and agentic workflows across the organisation. The AI Centre of Excellence (CoE) is accountable for turning that ambition into deployed, measured, production workflows across priority business functions. The CoE is small, senior and high-leverage. It sets architecture and standards, builds reusable capability, and delivers through a combination of internal engineering and external implementation partners. This is one of six foundational hires and the first dedicated engineering hire in the team. The Senior AI Engineer is the primary builder in the CoE.…

Read the full description on Qadinc's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, python, java, go, elasticsearch…

2

Level fit

This role is principal-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Pune. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptpythonjavagoelasticsearchopensearchpineconeweaviateawsgcpsagemakeriamterraformcdkserverlessllamaindexvertex aibedrockteamsoauthoidc

More at Qadinc

See all open jobs at Qadinc →