Senior Platform Engineer - ClickHouse
Foster Cityonsitesenior$125K – $145K
Posted today · via Workday
About this role
Come work at a place where innovation and teamwork come together to support the most exciting missions in the world! Senior Software Engineer (Data Platform, ClickHouse) We are seeking a highly motivated and talented Senior Software Engineer to work on Qualys’ next-generation Data Platform and middleware. For this position, we are looking for someone with expertise in ClickHouse. Working alongside a very talented team of engineers and architects, you will be responsible for prototyping, designing, developing and supporting a highly scalable SaaS based cloud security Data Platform.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: java, cassandra, redis, elasticsearch, clickhouse…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Foster City. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javacassandrarediselasticsearchclickhouseawsazuregcpkubernetesdockerconsulvaultterraformpuppetchefgrafanasparkkafkaflinkgradlemavenheap