Software Engineer
Puneonsitemid
Posted today · via Workday
About this role
Come work at a place where innovation and teamwork come together to support the most exciting missions in the world! We are seeking a highly motivated and talented Software Engineer to work on Qualys’ next-generation data platform and middleware. Working alongside a very talented team of engineers and architects, you will be responsible for prototyping, designing, developing and supporting a highly scalable SaaS based cloud security data platform. This is a great opportunity to be an integral part of a team building Qualys’ next generation microservices based technology platform processing over a 100 million transactions and terabytes of data per day, leverage open source technologies, and work on challenging and business-impacting projects.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: java, r, cassandra, elasticsearch, clickhouse…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Pune. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javarcassandraelasticsearchclickhouseawsazuregcpkubernetesdockerconsulvaultterraformpuppetchefgrafanasparkhadoopkafkaflinkteamsgradlemavenheap