Middle System Analyst
Kyivonsitemid
Posted 1mo ago · via Workable
About this role
Raiffeisen Bank is the largest Ukrainian bank with foreign capital. For more than 30 years, we have been creating and building the banking system of our country. Raiffeisen employs more than 5,000 employees, including one of the largest product IT teams, which includes 900+ specialists. Every day, we work side by side so that more than 2.5 million of our clients can receive quality service, use the bank's products and services, and develop their business, because we are #TogetherWithUkraine. Our team develops and supports an enterprise ECM platform for the banking and fintech sectors, focused on document management and business process automation.…
Read the full description on Raiffeisen Bank Ukraine's site →
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, go, kotlin, swift…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Kyiv. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavagokotlinswiftsqlangularspringelasticsearchawskubernetesdockervaultgithub actionsprometheusopentelemetrysparkkafkaflinkairflowgitgithubjirateams
More at Raiffeisen Bank Ukraine
- View →Менеджер з обслуговування клієнтів бізнес банкінгуVyshneve, Kyiv Oblast, Ukraine
- View →DevOps EngineerKyiv, Kyiv city, Ukraine
- View →Middle Site Reliability EngineerKyiv, Kyiv city, Ukraine
- View →Middle/Senior Java Integration DeveloperKyiv, Kyiv city, Ukraine
- View →Cloud Engineer for AIKyiv, Kyiv city, Ukraine
- View →Молодший менеджер по роботі з клієнтами міжнародного корпоративного бізнесуKyiv, Kyiv city, Ukraine
