System Analyst
Ukraineremotemid
Posted 1mo ago · via Workable
About this role
Raiffeisen Bank is the largest Ukrainian bank with foreign capital. For over 30 years, we have been shaping and developing the banking system of our country. At Raiffeisen, more than 5,500 employees work together, including one of the largest product IT teams, consisting of over 800 professionals. Every day, we collaborate to ensure that more than 2.7 million of our clients receive quality service, use the bank’s products and services, and develop their businesses because we are #Together_with_Ukraine.…
Read the full description on Raiffeisen Bank Ukraine's site →
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, go, kotlin, swift…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible. We factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavagokotlinswiftsqlelasticsearchawskubernetesdockervaultgithub actionsprometheusopentelemetrysparkkafkaflinkairflowgithubteams
More at Raiffeisen Bank Ukraine
- View →Менеджер з обслуговування клієнтів бізнес банкінгуVyshneve, Kyiv Oblast, Ukraine
- View →DevOps EngineerKyiv, Kyiv city, Ukraine
- View →Middle Site Reliability EngineerKyiv, Kyiv city, Ukraine
- View →Middle/Senior Java Integration DeveloperKyiv, Kyiv city, Ukraine
- View →Cloud Engineer for AIKyiv, Kyiv city, Ukraine
- View →Молодший менеджер по роботі з клієнтами міжнародного корпоративного бізнесуKyiv, Kyiv city, Ukraine
