R
Raiffeisen UkraineІнформаційні технології

Senior Android Developer

Kyivonsitesenior

Posted 5 days ago · via Workable

About this role

Raiffeisen Bank is the largest Ukrainian bank with foreign capital. For over 30 years, we have been shaping and developing the banking system of our country. At Raiffeisen, more than 5,500 employees work together, including one of the largest product IT teams, consisting of over 800 professionals. Every day, we collaborate to ensure that more than 2.7 million of our clients receive quality service, use the bank’s products and services, and develop their businesses because we are #Together_with_Ukraine. We develop and continuously improve the company’s internal compliance screening platform. Our product processes large volumes of real-time data, helping the business automate complex verification processes, minimize risks, and make faster decisions.…

Read the full description on Raiffeisen Ukraine's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, java, go, kotlin, swift…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Kyiv. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavagokotlinswiftelasticsearchawskubernetesdockervaultgithub actionsprometheusopentelemetrysparkkafkaflinkairflowgithubteamsgradle

More at Raiffeisen Ukraine

See all open jobs at Raiffeisen Ukraine