Java Developer
Lagosonsitemid
Posted 4mo ago · via Workable
About this role
Who We Are We’re a passionate team determined to challenge the status quo and make financial inclusion count for the millions of under-banked individuals and small business owners in Nigeria. We provide loans, savings, and fixed deposit solutions to our customers. Our vision is to be the most convenient lending company, delivering outstanding service experience. The Role The Java Developer will join one of our core engineering teams Banking, Loans, Core Technology Platform, or Cards to design, develop, and maintain the backend systems that power our financial products and internal platforms. This role is ideal for a software engineer who is passionate about backend development, software craftsmanship, and building scalable, high-performance systems.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: java, spring, spring boot, restful, mysql…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Lagos. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javaspringspring bootrestfulmysqlredisawseksgrafanakafkateams