Staff Software Engineer - Esports Platforms
Los Angelesonsitestaff
via Greenhouse
About this role
Riot engineers bring deep knowledge of specific technical areas but also value the opportunity to work in a variety of broader domains. We work with both new and current technology, creating innovative solutions to overcome high-volume obstacles and to deliver player value. Riot Games Esports is setting the standard for the industry. We're looking for passionate individuals with a desire to build products that serve as a gateway to sports fandom. As a Staff Software Engineer in the Esports Platforms team, you will work with a team of producers, designers, and engineers to prototype, build, and own products to foster the Esports ecosystem. The web application this role owns, develops, and maintains sits at the heart of Riot Esports.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, graphql, vercel, netlify…
2
Level fit
This role is staff-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Los Angeles. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreactgraphqlvercelnetlifyteams
More at Riot Games
- View →3D Character Artist - Unpublished R&D ProductShanghai, China
- View →3D Environment Artist - Unpublished R&D Product (Contract)Guangzhou, China
- View →APAC Esports Partnership ManagerSeoul, Korea
- View →Cloud Infrastructure and Security Engineer (Contract)Shanghai, China
- View →Concept Artist, Character -Unpublished R&D Product (Contract)Guangzhou, China
- View →3D Character Artist (Contract)Guangzhou, China