Rjt1Information Technology

Salesforce Developer

Matawanonsitemid

Posted 130mo ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About Diverse Lynx is among the fastest growing Technology Firms in NJ ( Ranked 3rd in Deloitte Fast 50 in 2007) . Diverse Lynx with 350 plus IT consultants and developers in USA have acquired tacit knowledge over many years and use specialized tools and techniques to deliver any project assignment for the customer. The IT Staffing/Consulting Services of Diverse Lynx provides Contract & Permanent resources to its customers for e-Business, Client Server, ERP, Legacy and Networking areas. The IT Solutions Services, deliver the entire spectrum of the software application from inception to deployment by providing cross-platform skills and knowledge to execute all phases of system development life cycle.…

Read the full description on Rjt1's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, php, sql, html, css…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Matawan. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpsqlhtmlcss.netmysqlsalesforce

More at Rjt1

See all open jobs at Rjt1 →