RrstaffingInformation Technology

Solutions Architect

San Franciscoremote

Posted 56mo ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About Our company specializes in small-to-mid commercial property and casualty insurance through our local and national network. We are one of the longest continuously operating companies in California We believe offer our employees’ healthy work-life balance, including a 4-day work week and generous benefit package. Seeking a Solutions Architect with a proven track record of planning and delivering mission critical software to production Solutions Architect with a proven track record of planning and delivering mission critical software to production Our current technical stack consists of applications running on or backed by Docker, NGINX, PHP 7, mySQL, Javascript (VueJS), Redis, and COBOL.…

Read the full description on Rrstaffing's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, php, laravel, mysql, redis…

Level fit

We check your title trajectory against the seniority signal of the role.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphplaravelmysqlredisdockerteams

More at Rrstaffing

See all open jobs at Rrstaffing →