S
SallaAI and Data Analytics

Senior Data Science - Integrity

Jeddahonsitesenior

Posted 1mo ago · via Workable

About this role

Protect millions of buyers and sellers as our Senior Data Scientist for Integrity & Trust. You'll lead building the AI defense systems that detect fraud, eliminate counterfeit products, and maintain marketplace quality across our platform. In MENA's high-COD environment (75% of transactions), trust is everything. Your models will be the difference between platform growth and reputation damage. Responsibilities Build and deploy supervised and unsupervised ML models for policy violation detection, counterfeit detection, and fraud detection. Build and grow the Integrity, Safety & Trust pod, mentor applied data scientists and deliver end-to-end projects with measurable business outcomes. Design feature pipelines that leverage product text, images, seller behavior, and transaction data.…

Read the full description on Salla's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, sql, redis, grafana, kafka…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Jeddah. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsqlredisgrafanakafkascikit-learnpytorchtransformersmodalteams

More at Salla

See all open jobs at Salla