Senior Data Science - Integrity
Jeddahonsitesenior
Posted 1mo ago · via Workable
About this role
Protect millions of buyers and sellers as our Senior Data Scientist for Integrity & Trust. You'll lead building the AI defense systems that detect fraud, eliminate counterfeit products, and maintain marketplace quality across our platform. In MENA's high-COD environment (75% of transactions), trust is everything. Your models will be the difference between platform growth and reputation damage. Responsibilities Build and deploy supervised and unsupervised ML models for policy violation detection, counterfeit detection, and fraud detection. Build and grow the Integrity, Safety & Trust pod, mentor applied data scientists and deliver end-to-end projects with measurable business outcomes. Design feature pipelines that leverage product text, images, seller behavior, and transaction data.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, redis, grafana, kafka…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Jeddah. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlredisgrafanakafkascikit-learnpytorchtransformersmodalteams
More at Salla
- View →Engineering Manager - EnterpriseMakkah, Makkah Province, Saudi Arabia
- View →UI Design Coordinator (Tamheer Program)Makkah, Makkah Province, Saudi Arabia
- View →Head of SecurityMakkah, Makkah Province, Saudi Arabia
- View →AccountantMakkah, Makkah Province, Saudi Arabia
- View →Senior Data Scientist - Recommendation Systems PodMakkah, Makkah Province, Saudi Arabia
- View →Category Manager - MahallyJeddah, Makkah Province, Saudi Arabia
