S
SeekOther

Graduate Software Engineer

Kuala Lumpurhybridjunior

Posted today · via Smartrecruiters

About this role

About About SEEK At SEEK, we serve a noble purpose: to help people live more productive and fulfilling working lives and to help organisations succeed. By joining us, you’ll be part of a multinational technology business that is far-reaching with a start-up working culture that focuses on a set of collaborative values and appreciates dynamic cultures. SEEK is a place where potential meets possibility – it’s where your career aspiration and our purpose can make great things happen. Why join us? Be part of a multinational tech company with strong core values to help us solve complex challenges while building a flexible, exciting career – one that could take you anywhere.…

Read the full description on Seek's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, react, graphql, aws, teams…

2

Level fit

This role is junior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Kuala Lumpur. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptreactgraphqlawsteamszoom

More at Seek

See all open jobs at Seek