Frontend Design Systems Engineer
United Statesremotemid$144K – $170K
Posted 3w ago · via Workable
About this role
This is a frontend system engineering role focused on evolving Seeq’s design system and reusable application patterns for a complex enterprise product. You will shape not just UI primitives, but the broader frontend foundations that teams use to build clear, consistent, high-quality experiences across data-dense workflows. We are looking for an exceptional frontend engineer with strong product sense, visual judgment, and experience crafting production-grade design systems loved by users and developers alike. What You Will Do You will lead the evolution of Seeq’s frontend system, improving component quality, consistency, usability, and developer experience across the product.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, html, react, tailwindcss, figma…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescripthtmlreacttailwindcssfigmateamszoom