Senior Big Data Engineer - Security Research / Detection
Brnoonsitesenior$10K – $21K
via Greenhouse
About this role
Our Purpose
At SentinelOne, we are driven by a clear purpose: to give the advantage to those who secure our future. As AI reshapes how organizations build, operate, and innovate, the responsibility to protect them becomes more critical than ever. When you join SentinelOne, your work helps protect global enterprises, critical infrastructure, and the technologies shaping tomorrow. If you are motivated by meaningful challenges and want your impact to be real, measurable, and global, you will find purpose here.
About Us
SentinelOne is a company at the intersection of AI and security, pioneering a new operating model for cybersecurity.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, scala, r, aws…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Brno. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavascalarawsgcpgrafanasparkhadoophivetableauteams
More at Sentinellabs
- View →AVP, SalesGermany
- View →Channel Business Manager, BeneluxNetherlands
- View →Commercial Account ExecutiveMountain View, California, United States
- View →Commercial Account Executive - DC AreaWashington, District of Columbia, United States
- View →Commercial Solutions Engineering InternSingapore
- View →Associate Solutions EngineerIndia
