Software Engineer, Design System - Fixed Term Mat Contract
Aucklandonsitemid
Posted 3w ago · via Workable
About this role
At Serko, we believe something incredible happens when people come face-to-face. That’s why we’re on a mission to engineer a frictionless, next-generation business travel marketplace. We don’t just manage travel; we are leveraging advanced AI and cutting-edge tech to eliminate the complexity of global movement. When you join Serko, you join a global collective of passionate technologists who show up as their true selves to build world-class products. With established hubs across New Zealand, Australia, North America, India and China - your code and ideas will impact millions of corporate travelers worldwide.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, tailwind, figma, teams
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Auckland. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreacttailwindfigmateams
More at Serko
- View →Senior Software Engineer - B4BAuckland, Auckland, New Zealand
- View →Expression of Interest - Product Support AnalystDallas, Texas, United States
- View →Software Engineer - B4BAuckland, Auckland, New Zealand
- View →Senior Engineer - AIAuckland, Auckland, New Zealand
- View →Software Engineer - Serko.aiAuckland, Auckland, New Zealand
- View →Data EngineerBengaluru, Karnataka, India