Team Lead, Onboarding
United Statesonsitesenior
via Greenhouse
About this role
About Us
At SimplePractice, we are improving access to quality care by equipping health and wellness clinicians with all the tools they need to thrive in private practice.
More than 250,000 providers trust SimplePractice to build their business through our industry-leading software with powerful tools that simplify every part of practice management. From admin work to clinical care, our suite of innovative solutions work together to reduce administrative burden—empowering solo and small group practitioners to thrive alongside their clients.
Award-winning and people-first, SimplePractice is shaping the future of health tech. Recognized by MedTech Breakthrough, the Digital Health Awards, and BuiltIn's Best Places to Work.
The Role…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: asana, monday, slack, teams, gdpr…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in United States. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
asanamondayslackteamsgdprhipaapci-dssworkday
More at Simplepractice
- View →Lifecycle Marketing ManagerUnited States
- View →Senior Manager of Product Marketing, Billing & InsuranceUnited States
- View →Support SpecialistUnited States
- View →Senior Manager, Enterprise MarketingUnited States
- View →Vice President of Community & BrandUnited States
- View →Executive Assistant (Operations Partner)United States
