Senior Full Stack Engineer (Python / React)
Londononsitesenior
Posted 1mo ago · via Workable
About this role
London, UK · Hybrid (3 days in our Paddington HQ: Mon, Tue, Fri) · Stack: Python, Flask, SQLAlchemy, React, TypeScript, MySQL, AWS In 2018 we set out to solve a problem millions of people faced: not just struggling with their skin, but struggling to navigate skincare at all. We combined dermatology, pharmacy and technology into something simpler and genuinely personalised, and proved expert-led care could reach people who'd never had access to it. Today, +Me is the company behind Skin + Me, Hair + Me and Renew + Me , with more on the horizon. We're not building a single brand. We're building a category. We've delivered millions of treatments, we're profitable and growing fast, and we're expanding the engineering team to match.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, python, react, flask, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in London. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptpythonreactflaskmysqlsqlalchemyawsclaude
More at Skin + Me
- View →EngineerPark Royal, United Kingdom
- View →Backend Engineer (Python)London, England, United Kingdom
- View →Backend Engineer (Node / Typescript)London, England, United Kingdom
- View →Senior Full Stack Engineer (Node / Typescript / React)London, England, United Kingdom
- View →Full Stack Engineer (Python / React)London, England, United Kingdom
- View →German-Speaking Doctor / Physician (Remote - Bulgaria)Bulgaria
