reqspace
Start free trial →
S
Skin + MeTech

Senior Full Stack Engineer (Python / React)

Londononsitesenior

Posted 1mo ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

London, UK · Hybrid (3 days in our Paddington HQ: Mon, Tue, Fri) · Stack: Python, Flask, SQLAlchemy, React, TypeScript, MySQL, AWS In 2018 we set out to solve a problem millions of people faced: not just struggling with their skin, but struggling to navigate skincare at all. We combined dermatology, pharmacy and technology into something simpler and genuinely personalised, and proved expert-led care could reach people who'd never had access to it. Today, +Me is the company behind Skin + Me, Hair + Me and Renew + Me , with more on the horizon. We're not building a single brand. We're building a category. We've delivered millions of treatments, we're profitable and growing fast, and we're expanding the engineering team to match.…

Read the full description on Skin + Me's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, python, react, flask, mysql…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in London. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptpythonreactflaskmysqlsqlalchemyawsclaude

More at Skin + Me

See all open jobs at Skin + Me →