Senior Fullstack Software Engineer - React
remotesenior$180K – $250K
via Ashby
About this role
ABOUT SOMETHINGS
Somethings is building the first social wellness platform for teens — a place where a teen can form a real relationship with a mentor who gets them, sticks with them, and helps them get better.
25 Million teens in the U.S. are struggling with their mental health. Every one of the thousands of teens who downloads Somethings is struggling. Our job is to make sure they don't just show up — they stay, connect with real humans who care deeply about them, and get the support that they need to thrive.
We're backed by General Catalyst and world-class healthcare + consumer investors, and we're growing like crazy — in 2025 we grew 1100%, and are on track to 5x in 2026.
If you want to be a part of the generationally defining company in mental health, welcome home.
ROLE OVERVIEW…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, javascript, css, react, next.js…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptjavascriptcssreactnext.jsreduxzustandtanstacktailwindgraphqlprismagitgitlabteamsloomjson
